PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011074537.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 629aa    MW: 70395.6 Da    PI: 6.3745
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011074537.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.53e-24131232199
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+kvlt sd++++g +++ +k+a+e+       +  ++ +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  XP_011074537.1 131 FCKVLTASDTSTHGGFSVLRKHANEClpsldmtQ--QTPTQELIAMDLHGIEWHFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGE 221
                     99****************************9643..445569************************************************..449 PP

                     EE..EEEEE-S CS
              B3  89 efelvvkvfrk 99 
                     ++el+v+v+r+
  XP_011074537.1 222 SGELRVGVRRH 232
                     99*******97 PP

2Auxin_resp98.59.5e-33257336183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+ t++ F v+Y+Pr+  s+F++ ++k+++a+++k+ vGmRf m+fe+eds+err+sGt+vgv+d++p +W++SkWrsLk
  XP_011074537.1 257 ASHAVLTRTLFVVYYKPRT--SQFIIGLNKYLEAVSRKFGVGMRFTMRFEGEDSPERRFSGTIVGVEDISP-HWEDSKWRSLK 336
                     689999************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.24E-39122260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-40122246IPR015300DNA-binding pseudobarrel domain
CDDcd100171.25E-20129231No hitNo description
PfamPF023622.7E-22131232IPR003340B3 DNA binding domain
PROSITE profilePS5086312.125131233IPR003340B3 DNA binding domain
SMARTSM010196.0E-22131233IPR003340B3 DNA binding domain
PfamPF065072.6E-30257336IPR010525Auxin response factor
PfamPF023092.6E-7509564IPR033389AUX/IAA domain
SuperFamilySSF542772.16E-12525604No hitNo description
PROSITE profilePS5174526.174528609IPR000270PB1 domain
PfamPF023091.3E-5574611IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MANRWSFSQQ QNSCFSAEGG GRKDLLYGEL WKACAGPLVD VPVVGERVYY FPQGHMEQLE  60
ASTNQELNQR KPMFNLPPKI LCRVFDIQLL AEQDTDEVYA QITLMPEADQ PEPTSPDDAP  120
DEPPRPVVHS FCKVLTASDT STHGGFSVLR KHANECLPSL DMTQQTPTQE LIAMDLHGIE  180
WHFKHIFRGQ PRRHLLTTGW STFVTSKRLV AGDSFVFLRG ESGELRVGVR RHAHQQSSMP  240
SSVISSQSMH LGVLATASHA VLTRTLFVVY YKPRTSQFII GLNKYLEAVS RKFGVGMRFT  300
MRFEGEDSPE RRFSGTIVGV EDISPHWEDS KWRSLKVQWD EPASIPRPER VSPWEIEPFS  360
VSVPTSLVQP PTMKHKRPRP RVEIPVSEAG WQSSPRVNAS PNLIADETEE NRSASALSVI  420
SNQSAPNSAK LSNSPVPCQK ESKSDTVATC RLFGVDLNSP SLVPPHENAS LKPADAPQDA  480
EVYIPSVLLS GDLEQKSSVS RDSKEPPKKG QLQVPTKDVQ SRQSHSTRSR TKVQMHGVAV  540
GRAVDLTTLN GYDELITELE EMFEIKGELR PRNKWEIVFT DDEGDTMLVG DDPWPEFCNM  600
VRRIFICSNQ DVKKMKGSKL PLPSAECED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1791936012356Auxin response factor 1
4ldw_A1e-1791936012356Auxin response factor 1
4ldw_B1e-1791936012356Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375379KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074533.10.0PREDICTED: auxin response factor 9-like
RefseqXP_011074537.10.0PREDICTED: auxin response factor 9-like
RefseqXP_011074547.10.0PREDICTED: auxin response factor 9-like
RefseqXP_011074555.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A022Q6Q90.0A0A022Q6Q9_ERYGU; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9